RVC
JobsFor Employers
  1. Jobs
  2. /
  3. Senior Backend Engineer - DevOps

Senior Backend Engineer - DevOps

Guidewire | Insurance software
1h 12m ago
Remote In-Country
Full Time
IC
Poland
€5125 - €6150 EUR/mo≈ $69.3k - $83.1k USD/yr
Source not independently verified - confirm the company domain before applying.
SummaryDo you understand the power of persistence? Are you ready to get better every day? We're looking for a Fullstack Engineer to join our development team remotely. You’ll play a key role in building products that improve the experience of millions of Guidewire customers worldwide. Working in a team of specialists who have a shared commitment to push further and achieve more. At Guidewire, we're changing the face of insurance. Developing and delivering technology that's crafting the future of the property and casualty industry. We're a global team of more than 3,500 working at scale and speed across a 1 billion dollar platform that gives insurers the tools they need to take care of their customers. Individually mastering our craft, to collectively empower millions. Guidewire Pricing and Rating TeamWe are part of the team responsible for building and maintaining an insurance pricing platform, which enables insurers to build and deploy advanced pricing models. Leveraging a modern technology stack, machine learning libraries and cloud infrastructure (AWS, Docker, Kubernetes), the platform ensures scalability, performance, and security - driving higher profitability for insurers and greater satisfaction for policyholders. The Pricing and Rating platform is a strategic initiative of Guidewire, receiving significant focus and momentum, particularly from a recruitment and resources perspective. You’d be joining a growing team of ~15 engineers divided into agile pods, working on a young product, on a fresh codebase, where lots of decisions still need to be made. Our teams take ownership of all aspects of the software development lifecycle for their solutions, including architecture, coding, quality assurance, infrastructure and deployment strategies. We cooperate with the product team on a daily basis and support sales and customers success teams to drive our product excellence. We value radical candor, curiosity and proactiveness. Job DescriptionTech Stack: Backend: Python 3.13, FastAPI, Flask, SQLAlchemy, Pydantic, CeleryFrontend: React 19, TypeScript, Tanstack, MUIInfrastructure: AWS, Azure, Kubernetes, PostgreSQL, RedisYour daily work will consist of: Research, develop and maintain modelling, insurance pricing algorithms, visualizations proprietary solutionsFullstack development with TypeScript and PythonAnalysing requirements, proposing solutions, spiking, building PoCs and production grade, well tested solutions and releasing themSupporting, optimizing and maintaining our solutions to meet our SLOsCooperating with team members through PR reviews, RFCs/ADRs and agile ceremoniesYou are our next Talent if you have: Python development experience (minimum of 2 years)Experience with some of the following: FastAPI, SQLAlchemy, Pydantic, CeleryTypeScript development experience (minimum 1 year)Experience with hooks, testing-libraryExperience with delivering production grade solutions and solving problems at scaleFamiliarity with Docker and KubernetesStrong foundation in algorithmics and data structuresA high sense of responsibility, good work ethic and a natural curiosity and openness to new ideas and toolsExcellent communication skills with the ability to articulate complex technical concepts in an English-speaking environmentYou are ready to face challenges and solve complex technical problems. You enjoy working with people and don't mind occasional face to face meetings with the team when neededNice to have: Experience using public cloud providers, preferably AWSExperience in taking ownership of quality through test automationExperience in building microservices exposing RESTful APIs in PythonExperience with Tanstack, react-hook-farm, viteAbout GuidewireGuidewire is the platform P&C insurers trust to engage, innovate, and grow efficiently. We combine digital, core, analytics, and AI to deliver our platform as a cloud service. More than 540+ insurers in 40 countries, from new ventures to the largest and most complex in the world, run on Guidewire. As a partner to our customers, we continually evolve to enable their success. We are proud of our unparalleled implementation track record with 1600+ successful projects, supported by the largest R&D team and partner ecosystem in the industry. Our Marketplace provides hundreds of applications that accelerate integration, localization, and innovation. For more information, please visit www.guidewire.com and follow us on Twitter: . Guidewire Software, Inc. is proud to be an equal opportunity and affirmative action employer. We are committed to an inclusive workplace, and believe that a diversity of perspectives, abilities, and cultures is a key to our success. Qualified applicants will receive consideration without regard to race, color, ancestry, religion, sex, national origin, citizenship, marital status, age, sexual orientation, gender identity, gender expression, veteran status, or disability. All offers are contingent upon passing a criminal history and other background checks where it's applicable to the position.

Required Skills

pythonfastapiflasksqlalchemypydanticcelerytypescriptreact

Required Languages

🇬🇧 English

Related searches

  • Remote Jobs in Poland
  • Jobs in Poland
  • Remote In-Country Jobs
  • Senior Jobs
1 jobs
Sort by
1h 12m ago

Senior Backend Engineer - DevOps

Guidewire·Insurance software
€5125 - €6150 EUR/mo≈ $69.3k - $83.1k USD/yr
pythonfastapiflasksqlalchemypydantic+3
📡Remote In-Country
|Poland
General Full-Stack Engineering
No similar jobs match these filters. Try changing or clearing a filter.
Popular job searches ▸
Remote roles
C# / .NET
Countries
United StatesUnited KingdomCanadaUS & EMEAGermanyPolandSpainNetherlandsPortugal
Experience
SeniorMid-levelJunior
R© 2026 RVC Globalbuild 163c5878
AboutMCPPricingContactPrivacyCookiesRefundsTerms & ConditionsFor Employers