RVC
JobsFor Employers
11 jobs
Sort:
2h 17m ago

Senior Software Engineer, Clinical

ECP·SaaS software
📡Remote In-Country
|Chicago, United States of America
angularjsqa_automationawsdata_science/data_engineering+6
Similar jobs
1h 2m ago

Senior Software Engineer

Boulevard Labs, Inc.·Software
📡Remote In-Country
|New York City, United States of America
$128k - $180k USD/yr
awsdatadoggraphqlpostgresql+5
2h 18m ago

Staff Software Engineer

Flex·FinTech
🏢Hybrid
|New York, United States of America|Relocation
$170k - $250k USD/yr
ab_tetingamplitudeapiappsflyer+22
5h 29m ago

Full Stack Developer (Java / Spring Boot / Vue.js / Oracle PL/SQL)

Antal Sp. z o.o.·Human Resources and Recruitment
🏢Hybrid
|Kraków, Poland
ansibledevopsgithubhtml+6
8h 18m ago

Java Full Stack Developer

🏢On-site
|Bengaluru, India
₹300k - ₹2.2M INR/yr
angularjsapiawsbdd+26
9h 50m ago

Product Growth Engineer

SpotmyEnergy·Energy/Cleantech
🏢On-site
|Berlin, Germany
ab_tetingapibackend_developmenthubspot+3
12h 16m ago

Software Engineer

Aura·Digital safety technology
📡Remote In-Country
|United States of America
$130k - $165k USD/yr
ab_tetinganalyticsawsci/cd+11
13h 25m ago

Full-Stack Engineer

Adobe·Technology
🏢On-site
|San Jose, United States of America
$139k - $257.5k USD/yr
apiawsazurecloud_services+8
15h 33m ago

Full-Stack Developer

DEMV Systems GmbH·Software Development
📡Remote In-Country
|Hamburg, Germany
ai_toolsapijavascriptlaravel+8
15h 41m ago

Full-Stack Engineer

VisioLab·Software
🏢Hybrid
|Berlin, Germany
agilecomputer_visionfigmafirebase+12
19h ago

Python Developer

AlmavivA de Belgique·Information technology
🏢On-site
|The Hague, Netherlands
authorizationazureci/cddata_science/data_engineering+17

Senior Software Engineer, Clinical

ECP | SaaS software
2 hours 17 minutes ago
Remote In-Country
Full Time
United States of America, Chicago, New York, Denver

About ECP 

ECP is a market-leading SaaS solution that enables senior living communities to better care for their residents. ECP is used in over 8,000 communities. We're looking to further expand by increasing the number of customers that use our software and increasing the scope of how we serve our customers by developing and releasing new products. 

Senior living is deeply under-penetrated with software and ECP is one of the largest and fastest-growing software companies in the industry. We recently raised a growth round of equity to reinvest in our product, technology, and go-to-market. Our mission is to build world-class software that improves the quality of life for seniors and improves clinical, business, compliance, and operational performance for our customers. 

The Role 

The clinical product is ECP's flagship, and caregivers are in it every shift. When a nurse documents a medication administration or a care aide records an overnight observation, that's our software. 

The team you'd join builds the next generation of it. The new platform is live and customers are using it, but most clinical functionality still sits in ColdFusion and AngularJS. We move customers a function at a time, so a caregiver can be in the new platform for one task and in ColdFusion for the next. Finishing that migration is the near-term work, and we're doing it with AI. The hard part is proving a migrated workflow still does what it did before. 

You'd report to the Senior Engineering Manager for Clinical, on a team of four engineers with a tech lead and a dedicated product manager. You'd own clinical domains end to end, moving them onto the new platform for most of your first year and building new capability on them after that. 

The stack: The new code is Node, React, and TypeScript on AWS, with domain-driven design and an event bus between the products. Data is SQL Server on a single-tenant database model, one per community. You won't write much ColdFusion, but you'll read plenty of it. 

What You'll Build 

The migration. You'll take a workflow that lives in ColdFusion today, work out what it does including the parts nobody wrote down, and rebuild it. You own that domain through to production, and you write the tests that prove it works. Not all of it carries over unchanged. The medication administration workflow is already redesigned and waiting, and you'll settle with product up front which differences are deliberate, so nobody reads one as a regression later. 

New clinical capability. Once a domain lands on the new platform, the team builds on it. You'll work with the product manager on scope and sequencing, and we expect you to push back when there's a cheaper way to get a caregiver the same outcome. 

The quality bar. The team is moving toward engineer-owned automated coverage in Playwright, and we want it to go further. You carry the pager for the domains you build.

What Success Looks Like 

At six months the migration is well underway, and several of the domains that moved are yours. Caregivers are using them. The team has taken its cues from you on what AI-generated work is fit to merge, and review isn't where the migration slows down. 

Past the migration, this job is new clinical capability, and the measure is how quickly a caregiver gets something they asked for. 

Required 

  • Depth in TypeScript on both sides of the stack, Node on the server and React in the browser. Tell us about a feature you took from the data model to the interface, and what you'd model differently now. 
  • AI-assisted development is how you work, daily, on production code, and you know where you stopped trusting it. 
  • You've pointed AI at a large codebase you didn't write and gotten useful work out of it. The part we want to hear about is what you did when the first answer was confidently wrong because the model couldn't see enough of the system. 
  • You've moved other engineers along in how they use AI. 
  • Domain-driven design in a complex domain. The version that matters here is drawing a boundary against a system you can't change, so tell us about one you drew and what it cost you when it landed in the wrong place. 
  • You've built software where a defect has consequences past a bad user experience, and it changed how you test and how you ship. You were on call for it. 
  • Data modeling and query performance where the tenant model is the data model. You've found and fixed a query that was fine in development and fell over on your largest customer. 
  • You work with product instead of waiting on it. You've changed what got built by understanding the business problem behind a story. 

Preferred 

  • A legacy-to-next-generation migration you saw through, particularly one where both systems ran in production at the same time 
  • ColdFusion, or another language you inherited rather than chose 
  • HIPAA, PHI, or another regulated data environment 
  • SQL Server, AWS, event-driven architecture in production 
  • Offline-first or progressive web applications 
  • Playwright or comparable browser automation you owned yourself 
  • Healthcare, or time spent watching clinical staff work 

Required Skills

angularjsqa_automationawsdata_science/data_engineeringevent-driven_architecturenode_jsplaywrightreactmssqltypescript

Required Languages

🇬🇧 English

Roles
PythonJavaReactTypeScriptNode.jsGoRustDevOpsData scienceProductDesign
Remote
United StatesUnited KingdomCanadaGermanyPolandSpainNetherlandsPortugal
Work type
Fully remoteRemote in-countryHybridSeniorMid-levelJuniorAll jobs
R© 2026 ReVacancybuild f86aa222
AboutContactPrivacyCookiesRefundsTerms & ConditionsFor Employers