RVC
JobsFor Employers
10,041 active jobs · 50 shown
Sort:
1m ago

Technical Writer

Wheelabrator Group GmbH·Technical Writing · Industrial machinery manufacturing
🏢Hybrid
|Metelen, Germany
adobe_cloudadobe_indesignphotoshoptechnical_documentation
2m ago

Supply Technician

Akima·General · Government Contracting
🏢On-site
|Ramstein-Miesenbach, Germany
$49k - $83k USD/yr
2m ago

Systems Integration Engineer

Panasonic Avionics Corporation·General · Aerospace
🏢On-site
|Hamburg, Germany
linuxtcp_ip
3m ago

Principal Software Engineer

GitHub·Javascript · Software Development
📡Remote In-Country
|Germany
angularjsccsharpperformance_marketing+11
3m ago

SAP HANA Consultant

IBM·SAP · Technology and IT Services
🏢On-site
|Magdeburg, Germany
sqlsap
4m ago

Overhead Line Technician

Deutsche Bahn·General · Rail transportation and logistics
🏢On-site
|Dresden, Germany
6m ago

Staff Software Engineer

Aledade PBC·General Data Engineering · Healthcare Technology
📡Remote In-Country
|United States of America
awsazurecsharpperformance_marketing+19
Stop Searching

Let the jobs find you.

Get notified instantly when we find a job that matches your Role, Salary & Location.

No Spam 100% Free Tailored
8m ago

Head of Packaging

FlightStory·Content/SEO · Media
🏢On-site
|Los Angeles, United States of America
ab_tetingai_toolscopywritingyoutube
8m ago

Partnerships Delivery Executive

FlightStory·Sales/Customer Success/Key Account Management · Media
🏢Hybrid
|London, United Kingdom
digital_marketinggoogle_suitekeynotemedia_planning+3
36m ago

Director, Compounding Operations

Ro·Operations · Healthcare
🏢On-site
|Romeoville, United States of America
$175.5k - $206.5k USD/yr
compliance
37m ago

Machine Learning Engineer

Stripe·ML / AI Engineer · Financial technology
🏢Hybrid
|South San Francisco, United States of America
$212k - $318k USD/yr
apachedeep_learningmlml_algorithms+4
38m ago

Engineering Manager

Hadrian·General · Manufacturing
🏢On-site
|Los Angeles, United States of America|Relocation
$220k - $280k USD/yr
aicode_reviewdistributed_systemssoftware_architecture+1
38m ago

Site Reliability Director

Anduril Industries·General · Defense technology
🏢On-site
|Costa Mesa, United States of America
$253k - $336k USD/yr
automationcrmdistributed_systemserp+1
38m ago

Front End Engineer

Abridge·ReactJS · Healthcare technology
🏢Hybrid
|San Francisco, United States of America
$218k - $250k USD/yr
ai_toolsapidesign_systemselectron+5
39m ago

Full-Stack Engineer

Kindred·General Full-Stack Engineering · Travel technology and accommodation
📡Fully Remote
$190k - $220k USD/yr
apidata_science/data_engineeringexpographql+5
40m ago

Staff Software Engineer

Kong·WebDev · API and AI connectivity software
📡Remote In-Country
|San Francisco, United States of America
$150k - $275k USD/yr
gdprjwtoauthopenid_connect
40m ago

Presales Onboarding Engineer

Starburst·Solutions Architect · Enterprise data and analytics software
🏢On-site
|India
data_science/data_engineeringdistributed_systemshadoopkubernetes+1
41m ago

Software Engineer

Imply·General Infra/Network · Data analytics software
📡Remote In-Country
|Burlingame, United States of America
$155k - $215k USD/yr
apiqa_automationawsazure+9
42m ago

iOS Engineer

EarnIn·iOS · Fintech
📡Remote In-Country
|Vancouver, Canada
$199k - $244k USD/yr
restapicombineintegration_testingios+5
43m ago

RCM Lead Specialist

Virta Health·Accounting · Healthcare
📡Remote In-Country
|United States of America
$59k - $76.5k USD/yr
datajirasalesforce
44m ago

Billing Specialist

Virta Health·Accounting · Healthcare
📡Remote In-Country
|United States of America
$54.5k - $70.5k USD/yr
ai_toolscollectionsnetsuite
44m ago

Collections Lead

Virta Health·Accounting · Healthcare
📡Remote In-Country
|United States of America
$64.5k - $83.5k USD/yr
salesforce
1h 3m ago

Creative Intern

Hypebeast·Marketing/PR/Growth · Media
🏢On-site
|Hong Kong, Hong Kong
adobe_cloudai_toolsapiscanva+5
1h 3m ago

Facilities Admin Officer

Ninja Van·General Administration · Logistics
🏢On-site
|Calamba, Philippines
budgeting
1h 11m ago

Operations Intern

Emma – The Sleep Company·Operations · Consumer goods
🏢On-site
|Lisbon, Portugal
from €1250 EUR/mo
artificial_intelligenceanalyticsdataproject_management
1h 11m ago

Working Student

SAP·Graphic/3D/2D Design · Enterprise software
🏢On-site
|Walldorf, Germany
adobe_cloudcontent_managementfigmaoffice365+2
1h 11m ago

Finance Controller

Emma – The Sleep Company·Finance · E-commerce and consumer sleep products
🏢Hybrid
|Mexico City, Mexico
accountingifrsdynamicsexcel
1h 12m ago

Strategy Operations Intern

SAP·Operations · Enterprise software and cloud technology
🏢On-site
|Ho Chi Minh City, Viet Nam
ai_toolsexcel
1h 12m ago

UX Design Specialist

SAP America, Inc.·UX/UI · Enterprise software
🏢On-site
|Palo Alto, United States of America
$146.9k - $244.4k USD/yr
prototypingvisual_design
1h 12m ago

Learning Specialist

SAP·Education · Enterprise software
🏢On-site
|Munich, Germany
erpllmoffice365software_testing
1h 13m ago

AI Advisory Intern

SAP·Solutions Architect · Enterprise software
🏢On-site
|Newtown Square, United States of America
artificial_intelligencedata_science/data_engineeringerpml+1
1h 14m ago

Technical Expert

SAP·General · Enterprise software and cloud services
🏢On-site
|Bangalore, India
databaseslinuxnetworksproject_management+2
1h 15m ago

Security Compliance Expert

SAP·General InfoSec · Enterprise software and cloud computing
🏢On-site
|Berlin, Germany
ai_toolsiso_27001
1h 17m ago

User Acquisition Manager

UPLIVE Company·Performance / Growth Marketing · Mobile gaming
🏢On-site
|Ho Chi Minh City, Viet Nam
analyticsapplovincohort_analysiscompetitor_analysis+3
1h 24m ago

Business Development Director

Adobe·Business Development · Software and digital media
🏢On-site
|New York
$176.9k - $323.3k USD/yr
business_development
1h 28m ago

Sales Development Representative

SOTI·Sales/Customer Success/Key Account Management · Enterprise mobility technology
🏢On-site
|Gurgaon, India
networkingsalesforce
1h 32m ago

Systems Analyst

Anduril Industries·General · Defense technology
🏢On-site
|Abu Dhabi|Relocation
performance_marketinganalyticspythonyaml
1h 33m ago

Product Manager

Foodics·Product Management · Fintech
🏢On-site
|Riyadh, Saudi Arabia
ab_tetingfintechproduct_developmentproduct_management
1h 34m ago

Technical Recruiter

Anduril Industries·Recruitment/Talent Acquisition · Defense technology
📡Remote In-Country
|Costa Mesa, United States of America
$60 - $80 USD/hr
boolean_searchprocess_automation
1h 38m ago

Model Validation Specialist

Robinhood·General Legal · Financial Services
🏢Hybrid
|Denver, United States of America
$106k - $160k USD/yr
ai_toolsautomationdata_science/data_engineeringpython+3
1h 39m ago

Firmware Engineer

Samsara·General · Internet of Things
📡Fully Remote
|San Francisco
$162.4k - $290k USD/yr
qa_automationawsbashbuildroot+11
1h 40m ago

Product Builder

ShopBack·Product Management · E-commerce and financial technology
🏢On-site
|Singapore, Singapore
ai_toolstest_casesusability_testing
1h 43m ago

Data Scientist

Discord·Data Scientist (AI/ML) · Gaming and social platform
📡Remote In-Country
|San Francisco, United States of America|Relocation
$279k - $310k USD/yr
pythonrsqlstatistical_analysis
1h 53m ago

Accounting Analyst

Kraken·Accounting · Cryptocurrency and financial services
📡Remote In-Country
|United States of America
$47.3k - $94.6k USD/yr
cryptocurrenciesdataexcelnetsuite+2
1h 53m ago

Creative Designer

Lalamove·Motion Graphics/Video Editor · Logistics and delivery
🏢On-site
|Ho Chi Minh City, Viet Nam
adobe_cloudphotoshopanimationux_ui+1
1h 54m ago

Rust Software Engineer

Payward·Rust · Financial technology and cryptocurrency
📡Fully Remote
asynchronous_programmingdebuggingdistributed_systemskafka+5
1h 54m ago

Business Development Associate

Lalamove·Business Development · Logistics
🏢On-site
|Mexico City, Mexico
b2b_salescrmcustomer_servicedatabases+1
1h 57m ago

Business Development Manager

Everpure·Business Development · Data storage technology
🏢On-site
|Santa Clara, United States of America
$153k - $230k USD/yr
analyticscrmsalesforce
1h 58m ago

Product Manager

Rain·Product Management · Fintech
🏢On-site
|New York, United States of America
$50k - $999k USD/yr
apisblockchaindistributed_systemsmonitoring+3
1h 59m ago

Test Software Engineer

Roku·Automation QA · Streaming media technology
🏢Hybrid
|Cambridge, United Kingdom
artificial_intelligenceawsperformance_marketingci/cd+7

Data Solution Architect

Fusemachines | Solutions Architect | Artificial intelligence services
Fully Remote
Full Time

About Fusemachines

Fusemachines is a leading AI strategy, talent, and education services provider. Founded by Sameer Maskey Ph.D., Adjunct Associate Professor at Columbia University, Fusemachines has a core mission of democratizing AI. With a presence in 4 countries (Nepal, United States, Canada, and Dominican Republic and more than 400 employees). Fusemachines seeks to bring its global expertise in AI to transform companies around the world.

Remote (US or Canada)

Seeking a hands-on Senior Security Data Solution Architect with 7+ years of experience designing and implementing large-scale security data and analytics solutions within the financial services industry. The ideal candidate possesses deep security domain fluency, expertise in ingesting, normalizing, and standardizing security telemetry and SIEM logging, and a strong understanding of Databricks alongside Snowflake on AWS. Must have proven experience in data architecture leadership, business continuity, disaster recovery, high availability, and modern AI/agentic integration capabilities.

Responsibilities:

  • Architect end-to-end security data solutions on AWS, utilizing Databricks and Snowflake to integrate, normalize, and standardize disparate security telemetry and SIEM logs.  
  • Translate functional and non-functional security requirements into scalable data models, low-level designs, and standardized architectural artifacts.  
  • Provide technical leadership to build queryable, sustainable data storage layers that move away from BI-heavy dependencies and answer critical operational and risk metrics for the security leadership team.  
  • Guide and mentor data engineers and analysts on data modeling, pipeline development, and data architecture best practices.  
  • Design data governance solutions including metadata management, data cataloging, quality framework enforcement, and lineage tracking across security domain datasets.  
  • Evaluate and integrate AI/ML services and natural language interrogation layers (such as LLMs and agentic development tools) to streamline security incident analysis and bespoke data queries.  
  • Design highly available, scalable, and resilient data solutions, including disaster recovery and business continuity plans.  
  • Collaborate with cross-functional security, risk, and product management teams in an Agile environment. 

Qualifications:

  • Bachelor's degree in Computer Science, Information Security, or a related field.  
  • 7+ years of data architecture and hands-on engineering experience with a strong focus on security datasets and risk analytics in the financial industry.  
  • Deep expertise in security telemetry normalization, data integration, and SIEM (Security Information and Event Management) logging platforms.  
  • Hands-on experience with Databricks and Snowflake architectures, PySpark/Spark, SQL, data lakes/lakehouses, ELT/ETL pipelines, and stream processing tools (e.g., Kafka).  
  • Strong practical understanding of AWS cloud infrastructure and security tools.  
  • Familiarity with AI/ML services, LLMs, and agentic workflows for automated analytics.  
  • Strong understanding of SDLC, Agile methodology, and DevOps/DataOps principles.  
  • Excellent communication and leadership skills with the ability to translate technical security requirements into strategic data architectures. 

Preferred Certifications: 

  • Databricks Certifications: Databricks Certified Data Engineer Professional or Databricks Certified Solutions Architect.  
  • Snowflake Certifications: SnowPro Core or SnowPro Advanced Architect.  
  • Cloud Certifications: AWS Certified Data Engineer – Associate or AWS Certified Solutions Architect – Professional.  
  • Security Certifications: Certified Information Systems Security Professional (CISSP), Certified Cloud Security Professional (CCSP), or CompTIA Security+. 

Equal Opportunity Employer: Race, Color, Religion, Sex, Sexual Orientation, Gender Identity, National Origin, Age, Genetic Information, Disability, Protected Veteran Status, or any other legally protected group status.


 

Required Skills

agileapacheawsdatabricksdata_science/data_engineeringdevopsetlkafkallmpysparksdlcsiemsnowflakesql

Required Languages

🇬🇧 English

Key competency: Solutions Architect
Roles
PythonJavaReactTypeScriptNode.jsGoRustDevOpsData scienceProductDesign
Remote
United StatesUnited KingdomCanadaGermanyPolandSpainNetherlandsPortugal
Work type
Fully remoteRemote in-countryHybridSeniorMid-levelJuniorAll jobs
R© 2026 ReVacancy
AboutContactPrivacyCookiesRefundsTerms & ConditionsFor Employers